PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10001226
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 300aa    MW: 33768.6 Da    PI: 7.0626
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10001226genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.3e-162269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l + ++  G ++W+++++  g+ R++k+c++rw++yl
      Lus10001226 22 KGLWSPDEDERLFHFITSNGHPSWSSVPKLAGLQRCGKSCRLRWLNYL 69
                     678*******************************************97 PP

2Myb_DNA-binding46.67.8e-1575119147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T  E+  ++d +++lG++ W+ Ia++++ gRt++++k++w++y
      Lus10001226  75 RGGFTHKEERTIIDTHRMLGNR-WAQIAKYLP-GRTDNEIKNFWNSY 119
                      7889******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-221372IPR009057Homeodomain-like
PROSITE profilePS5129416.0471769IPR017930Myb domain
SuperFamilySSF466891.17E-2620116IPR009057Homeodomain-like
SMARTSM007171.9E-92171IPR001005SANT/Myb domain
PfamPF002492.9E-132269IPR001005SANT/Myb domain
CDDcd001673.38E-82569No hitNo description
PROSITE profilePS5129424.33370124IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2473125IPR009057Homeodomain-like
SMARTSM007172.3E-1374122IPR001005SANT/Myb domain
PfamPF002498.2E-1475119IPR001005SANT/Myb domain
CDDcd001671.31E-978120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MQRPKTAATT GHKCCTKQKV RKGLWSPDED ERLFHFITSN GHPSWSSVPK LAGLQRCGKS  60
CRLRWLNYLR PDLKRGGFTH KEERTIIDTH RMLGNRWAQI AKYLPGRTDN EIKNFWNSYV  120
KKKLISQGID PNTHNQLKVS SQSATTSSYS SSTSSLIFNV TPNQEQTTSS NIVNLPSIFF  180
PFNVDYDDTI NIRPLITPTT TNRVGHEIID DGLWGYGPGL QSNEKVVHHQ VQPTFSLDSK  240
SGVKFQGDGS VEWEMNDDSF EGSNLFDFDF GEPATNHPAG LEEIIATNYS GNDELWDVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29221247108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015056084.12e-78PREDICTED: transcription factor MYB46-like
TrEMBLA0A067L7B12e-77A0A067L7B1_JATCU; MYB family protein
STRINGSolyc10g005240.2.12e-74(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34663267
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.18e-74myb domain protein 67